PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10009129
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 289aa    MW: 32610 Da    PI: 8.7989
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10009129genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.36.6e-171663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W++eEd ll ++++ +G g+W++++++ g++R++k+c++rw++yl
      Lus10009129 16 RGTWSEEEDRLLRRCIQTYGEGRWHLVPARAGLNRCRKSCRLRWLNYL 63
                     89********************************************97 PP

2Myb_DNA-binding445.3e-1475113747
                      HHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   7 eEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       E +ll++++k+lG++ W++Ia +++ gRt++++k++w+++
      Lus10009129  75 AEADLLIRLHKLLGNR-WSLIAGRLP-GRTANDVKNYWNTH 113
                      6899************.*********.************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-211165IPR009057Homeodomain-like
PROSITE profilePS5129425.3271167IPR017930Myb domain
SuperFamilySSF466892.13E-2713110IPR009057Homeodomain-like
SMARTSM007175.5E-161565IPR001005SANT/Myb domain
PfamPF002492.0E-161663IPR001005SANT/Myb domain
CDDcd001671.28E-111863No hitNo description
Gene3DG3DSA:1.10.10.601.4E-2166117IPR009057Homeodomain-like
PROSITE profilePS5129416.45168118IPR017930Myb domain
SMARTSM007172.3E-1368116IPR001005SANT/Myb domain
PfamPF002492.2E-1270113IPR001005SANT/Myb domain
CDDcd001671.14E-876111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MEVAAAAAAG DHGLRRGTWS EEEDRLLRRC IQTYGEGRWH LVPARAGLNR CRKSCRLRWL  60
NYLKPNIKRG EFEGAEADLL IRLHKLLGNR WSLIAGRLPG RTANDVKNYW NTHHKEKEKK  120
KLTTTTASSC MPAAALTFPC KRQRHCTEPP VVLVTKPCPN EGKITKTNII RPRPMGLPKG  180
FCWRADKNKR AQSPFVADED MNGDGSSGTV WAQELKRFLD CVDNFPAATC SKMTEHNNSS  240
CSNYSSNDEI MKLGVEDLTM FDHQEEGNYQ SCGRDDDVSI WDLLQRSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-21141175107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002534011.22e-60PREDICTED: transcription factor MYB113
TrEMBLB9T6Z22e-60B9T6Z2_RICCO; R2r3-myb transcription factor, putative (Fragment)
STRINGPOPTR_0005s14480.15e-58(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66370.11e-53myb domain protein 113